PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.342770.1
Common NameCsa_3G865400, LOC101218246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 303aa    MW: 33808.2 Da    PI: 7.5616
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.342770.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702187.26.1e-581052393153
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                      g+++CqdCGnqakkdC+h RCRtCCksrgf+C+thvkstWvpaakrrerqqq +++ss+      +  +k +re+      +l+ t++      
  Cucsa.342770.1 105 GGGMNCQDCGNQAKKDCSHLRCRTCCKSRGFHCQTHVKSTWVPAAKRRERQQQRHQQSSD------QTVPKIHREN----PPSLTVTTT------ 183
                     5789**********************************************9998875433......3445555553....344444432...... PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                     + le  ++  e +s+avfrcv+vs++d+ ee+laYqtav+igGh+fkGiLydqG+e
  Cucsa.342770.1 184 SGLEHGNFQGEFNSSAVFRCVKVSAIDNVEEQLAYQTAVNIGGHMFKGILYDQGPE 239
                     346778899*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.8E-58107239IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.0E-27109151IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.7E-24191238IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MTELFYLDRK QEDDPENQRA RSEQQLFLYN SRSNNPQQIC SKEFQIWPQY YSHHNQHPPH  60
QNVENYISFG VGPSRRSSLM INAFDHDFVS RSGFTMTKHS GGGSGGGMNC QDCGNQAKKD  120
CSHLRCRTCC KSRGFHCQTH VKSTWVPAAK RRERQQQRHQ QSSDQTVPKI HRENPPSLTV  180
TTTSGLEHGN FQGEFNSSAV FRCVKVSAID NVEEQLAYQT AVNIGGHMFK GILYDQGPEY  240
SQNLSTGGDG EDGGEGLDLV IGASNGSGRV NNQSTPFVES SLYPIPINSF NNGMQFFPSS  300
RT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147842.20.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9XGX03e-64SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A0A0LDI90.0A0A0A0LDI9_CUCSA; Uncharacterized protein
STRINGGLYMA06G03030.19e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.14e-57Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]